PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1268s0051.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NF-YC
Protein Properties Length: 259aa    MW: 29152.1 Da    PI: 5.012
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1268s0051.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC54.42.8e-176861898
                NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                         ++++P +rikki+++de+v +i+  +P l+ska elf+ +l   ++  + +   +t+    ++++v + +ifdfl ++v +
  Cagra.1268s0051.1.p  6 QTRFPATRIKKIMQTDEEVGKIAMAVPLLVSKALELFLQDLCNHTYDITLSRGAKTVSSFHLKQCVHSFNIFDFLRETVNK 86
                         789*************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.4E-25272IPR009072Histone-fold
PfamPF008083.2E-17871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471133.49E-181888IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MKKKLQTRFP ATRIKKIMQT DEEVGKIAMA VPLLVSKALE LFLQDLCNHT YDITLSRGAK  60
TVSSFHLKQC VHSFNIFDFL RETVNKVPDL GGSDAEDQSA TKRRKLIEES NCNDEDFKST  120
QMYEVKNSGS GRGRRGRGRG RGNGKKGSGL SLKFEEDLED GSPESSRSPS PENRSHEYTS  180
WKKVASHNNP SNVRNFDLNV DLDENGDTAT WLERRLEGSP DWPLLGMNDM KLDPDQQQQQ  240
QASASDEEDY DEESTDQD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A5e-24271574Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1131141RGRRGRGRGRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006288499.11e-149hypothetical protein CARUB_v10001764mg
TrEMBLR0FGG81e-149R0FGG8_9BRAS; Uncharacterized protein
STRINGAT5G19490.11e-127(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139682124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G19490.11e-102NF-YC family protein